Loyal Biotechnology Co.,Ltd

Follistatin 344 Peptide

Follistatin is an interesting protein that is able to increase the muscle growth beyond natural limits by inhibiting myostatin, a hormone that regulates muscle growth negatively. Follistatin is naturally produced in almost all mammals. Follistatin works by binding and inhibiting myostatin. Myostatin also has a role in a regulation of fibrosis, too much myostatin can cause chronic diseases in internal organs, bones, and tissues.

Send InquiryChat Now
Product Details

Follistatin 344 peptide

Brief Introduction:

Product Name:

Follistatin 344

CAS No:

N/A

M.W.

37.80 kDa

Concentration:

1.0mg/ml

Endotoxin:

Less than 1EU/ug

Sequence:

GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKET CENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALL KARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGND GVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGG KKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECA MKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Purity

99% by SDS-PAGE gel analysis

Appearance

White crystalline powder

Package

1mg/Vials

Usage

Peptide hormones

Payment term

Western union, MoneyGram, Biotcoin, TT Bank transfer

Delivery Method

FedEx, DHL, UPS, TNT, EMS, HKEMS, etc


image001(001).jpg


What is Follistatin 344 ?

Follistatin is an interesting protein that is able to increase the muscle growth beyond natural limits by inhibiting myostatin, a hormone that regulates muscle growth negatively. Follistatin is naturally produced in almost all mammals. Follistatin works by binding and inhibiting myostatin. Myostatin also has a role in a regulation of fibrosis, too much myostatin can cause chronic diseases in internal organs, bones, and tissues.

 

Follistatin 344 Specification:

Complete certificate of analysis (COA) issued after every finished batch as follows:

image003.jpg


Follistatin 344 Benefit:   

  • Building lean muscle

  • Saves from effects of myostatin

  • Suppression of FSH

  • Not needed on regular basis

  • Short term drawbacks


Follistatin 344 dosage:

Dosage for a 10-day cycle:

Day 1: Split bilaterally into the muscle you want to bring up the most: 300mcg.

Day 3: Split bilaterally into the muscle you want to bring up the most: 200mcg.

Day 5: Split bilaterally into the muscle you want to bring up the most: 200mcg.

Day 7: Split bilaterally into the muscle you want to bring up the most: 300mcg.

The muscle building effects can last for up to 3 months afterward, slowly diminishing.

 

image019(001).jpgimage021(001).jpg

image023(001).jpgimage025.jpg


Production facility:

The factory has GMP guideline plant which is compliant with ISO9001:2008, with extremely strict production and quality system, dedicated to provide high quality steroid products.

image011.jpgimage013.jpg

image015.jpgimage017.jpg



1111.jpg


Hot Tags: follistatin 344 peptide, wholesale, price, buy, cycle, bodybuilding, muscle building, free sample
Related Products
Inquiry