Loyal Biotechnology Co.,Ltd

Follistatin 344 Peptide Hormones

Follistatin also is known as activin-binding protein is a protein that in humans is encoded by the FST gene. Follistatin is an autocrine glycoprotein that is expressed in nearly all tissues of higher animals. Its primary function is the binding and biol neutralisation of members of the TGF-β superfamily, with a particular focus on activin, a paracrine hormone.

Send InquiryChat Now
Product Details

Follistatin 344 peptide hormones

Product Description:  

98%+ Purity Follistatin 344 Raw Powder

image001.jpg


● The shipping cost: USD50

● Min order quantity: 10Vials Follistatin 344 powder

● Pacakge: Discreet parcel

● Delivery method: DHL,FedEx,UPS,TNT,EMS,HKEMS

● Payment terms: Western Union, MoneyGram, Bank transfer, Bitcoin

● Our Service:

Over 99.5% custom pass, delivery time within 5~7days.

Resend free product if the cargo was seized.

Quality guarantee system.


Follistatin 344 Specification:

Complete certificate of analysis (COA) issued after every finished batch as follows:

Product Name

Follistatin 344 Recombinant

Batch No.

P140180504

Molecular Formula

N/A

Molecular Weight

37.8 kDa

Sequence

GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPC KETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPE LEVQYQGRCKKTCRDVFCP GSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLA YEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDE PVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW

Mfgr. Date

May. 15th, 2018

Exp. Date

May. 14th, 2020

Test

Specifications

Results

Appearance

Fine White Lyophilized Powder

Conforms

Purity

99% by    SDS-PAGE gel analysis

Conforms

Concentration:

1.0mg/ml

Conforms

Endotoxin:

Less than    1EU/ug

Conforms

Storage term

12month from date of receipt, -20~ -70℃ as supplied
1month, 2~8℃ after reconstitution
Aviod repeated freeze thaw cycle.


What is Follistatin 344?

Follistatin also is known as activin-binding protein is a protein that in humans is encoded by the FST gene. Follistatin is an autocrine glycoprotein that is expressed in nearly all tissues of higher animals.
Its primary function is the binding and biol neutralisation of members of the TGF-β superfamily, with a particular focus on activin, a paracrine hormone.


Follistatin 344 application:

10-day cycle dose:

Day 1: Bilateral split into the muscle you want the largest: 300mcg.

Day 3: twins split into the muscles you want most: 200mcg.

Day 5: Bilateral split into the muscle you want most: 200mcg.

Day 7: Bilateral split into the muscle you want the largest: 300mcg.

Muscle construction effect can last up to 3 months, slow down.


image019(001).jpgimage021(001).jpg

image023(001).jpgimage025.jpg


Production facility:

The factory has GMP guideline plant which is compliant with ISO9001:2008, with extremely strict production and quality system, dedicated to provide high quality steroid products.

image011.jpgimage013.jpg

image015.jpgimage017.jpg



1111.jpg


Hot Tags: follistatin 344 peptide hormones, wholesale, price, buy, cycle, bodybuilding, muscle building, free sample
Related Products
Inquiry