Loyal Biotechnology Co.,Ltd

CJC-1295 No DAC Peptide Hormones

CJC 1295 is typically provided in vials containing 2 or 5 mg of lyophylized powder, though the amount can vary. The contents should be reconstituted by adding a convenient amount of sterile or bacteriostatic water. If for example 2 mL is chosen and the dosing of the vial is 2 mg, the resulting solution then has a concentration of 1 mg/mL, or 1000 mcg/mL.

Send InquiryChat Now
Product Details

CJC-1295 no DAC peptide hromones

Brief Introduction:

Product Name:

CJC-1295 NO DAC

Synonyms:

Modified GRF (1-29)

CAS:

863288-34-0

MF:

C152H252N44O42

MW:

3368.7

Sequence:  

Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2

Product Categories:

Peptide, peptide hormones, peptide and protein, Steroid and Hormone; Pharmaceuticals; Steroids

Structure:

image001.jpg

Purity

98%

Appearance

White crystalline powder

Package

5mg/10mg/Vials

Usage

Peptide hormones, bodybuilding

Payment term

Western union, MoneyGram, Biotcoin, TT Bank transfer

Delivery Method

FedEx, DHL, UPS, TNT, EMS, HKEMS, etc

image003.jpg


What is CJC-1295 NO DAC?

CJC 1295 NO DAC or Mod GRF(1-29), also known as, tetrasubstituted GRF (1-29), is an injectable peptide used to increase Growth Hormone production. It is in the class of Growth hormone releasing hormone (GHRH) analogs. Mod GRF(1-29) amplifies Growth Hormone pulse in the same fashion that GHRH does but it doesn’t induce the pulse of GH. That’s why it is recommended to combine Mod GRF(1-29) with a peptide of the GHRP (Growth hormone releasing peptide) category because if no GH pulse occurs during the time of Mod GRF(1-29) injection then it has nothing to amplify.


CJC-1295 NO DAC Specification:

Complete certificate of analysis (COA) issued after every finished batch as follows:

image005.jpg


CJC 1295 NO DAC application: 

Using both CJC-1295 NO DAC (MOD GRF 1-29) and a GHRP provides a synergistic response with the GHRP producing a GH pulse and the CJC-1295 NO DAC amplifying it.

- Increased fat loss

- Improved muscle gain

- Improved recovery

- Anti aging

- Deeper sleep

- Better skin and hair

 

CJC 1295 NO DAC dosage: 

CJC 1295 is typically provided in vials containing 2 or 5 mg of lyophylized powder, though the amount can vary. The contents should be reconstituted by adding a convenient amount of sterile or bacteriostatic water. If for example 2 mL is chosen and the dosing of the vial is 2 mg, the resulting solution then has a concentration of 1 mg/mL, or 1000 mcg/mL.

At time of dosing, an insulin syringe is used to draw and then inject the desired amount. In the above example, a 1000 mcg dose would require a volume of 1 mL, or “100 IU” as marked on an insulin syringe.

 


Production facility:

The factory has GMP guideline plant which is compliant with ISO9001:2008, with extremely strict production and quality system, dedicated to provide high quality steroid products.


Service policy:

  • Quick reply to inquiry within 12 hours.

  • Delivery time within 24 hours upon the recipt of payment.

  • Guarantee 99.5% custom pass, resend the cargo in case that it is seized and difficult to finish custom clearance by us.


image019(001).jpgimage021(001).jpg

image023(001).jpgimage025.jpg


Production facility:

The factory has GMP guideline plant which is compliant with ISO9001:2008, with extremely strict production and quality system, dedicated to provide high quality steroid products.

image011.jpgimage013.jpg

image015.jpgimage017.jpg



1111.jpg


Hot Tags: CJC-1295 no DAC peptide hormones, wholesale, price, buy, cycle, bodybuilding, muscle building, free sample
Related Products
Inquiry